PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018135-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 199aa    MW: 22794.5 Da    PI: 6.3943
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018135-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-17146192148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd  l  +v+ +G + W+ Ia++m+ gR +kqc++rw+++l
  AHYPO_018135-RA 146 KGQWTKEEDRHLTSLVNAHGERKWAIIAQKMN-GRAGKQCRERWHNHL 192
                      799*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.285141196IPR017930Myb domain
SMARTSM007173.8E-14145194IPR001005SANT/Myb domain
PfamPF002497.5E-16146192IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-18146196IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-22147197IPR009057Homeodomain-like
CDDcd001674.42E-13149192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEENLESFSF LLENQSLLLP SLHPPLPIKA IERFLVGGNR TTTTTTTTTT INANVAVDDP  60
PTTFDYYEYN LQNSSPPQSY YTNHPSYMYG VGNNNISPTI TMQDFVFVDE LFANENDDLA  120
KNNEVIHEVT NEGWRFKGKK CMTCIKGQWT KEEDRHLTSL VNAHGERKWA IIAQKMNGRA  180
GKQCRERWHN HLRPQIKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gvd_A9e-19145195252MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.13e-25myb domain protein 119